CoreDash Pricing

Full Core Web Vitals monitoring with real time attribution, deep segmentation, and AI/MCP access. Every plan includes every feature. No artificial limits on URLs or dashboards.

Start free trial

Trusted by market leaders · Client results

saturnmonarchdpg mediamarktplaatsadevintahappyhorizonkpnaleteiaperionvpnerasmusmcloopearplugsnina carecomparewhowhatwearfotocasamy work featured on web.devsnvebaynestleharvardworkiva

CoreDash pricing

Starter

$18 / mo
For small sites
  • 50K page-views / month
  • 60 days data retention*
  • track unlimited pages
  • 1 domain
  • CrUX tracking 

Standard

$35 / mo
Your best option
  • 150K page-views / month
  • 365 days data retention*
  • track unlimited pages
  • 2 domains
  • CrUX tracking 

Enterprise

$149 / mo
Enterprise level insights
  • 2M page-views / mo
  • 365 days data retention*
  • track unlimited pages
  • 3 domains
  • CrUX tracking 

Sentinel

$7 / mo
For sites that are allready fast and need to stay fast. Sentinel Mode tracks the Core Web Vitals in bursts saving resources and money.



Agency: for agency packages and custom solutions read this

Every feature. Every plan. No gated upsells.

Most RUM tools lock critical features behind enterprise tiers. CoreDash does the opposite. Real time attribution, request waterfalls, CrUX tracking, alerting, the visual explorer, and AI/MCP access are all included from the Starter plan up. The only difference between plans is pageview volume.

CoreDash measures Core Web Vitals using Google's official web-vitals library. The data on your dashboard correlates precisely with what appears in your CrUX report 28 days later. All data is processed and stored exclusively in the EU. No cookies. No personal data. No consent banners needed. That means you measure 100% of your traffic, not just the visitors who clicked "accept."

Plans scale with your traffic. Pick the tier that matches your monthly pageviews and get full access to everything CoreDash offers.

How CoreDash compares to other RUM tools

At every price point, CoreDash delivers more. Full feature access on every plan, CrUX tracking included, and AI/MCP support that no other Core Web Vitals tool offers.

Feature CoreDash Speetals SpeedCurveRUMvisionDebugBear
Lowest RUM price $18 $69 $83$95 $325
Core Web Vitals Yes Yes Yes Yes Yes
Page View Limits 150K 250K 500K750K 500K
CrUX Tracking Yes No NoNo Yes
AlertingIncludedIncludedIncludedIncludedIncluded
AI / MCP AccessIncluded--------
Full features on starterAll features30 pages onlyLimitedLimitedAll features

* Lowest monthly prices that include RUM tracking as of January 2025

MCP and AI rate limits

CoreDash includes a Model Context Protocol (MCP) server so AI agents like Claude and Cursor can query your live Core Web Vitals data directly. MCP requests share daily limits with CoreDash AI features. Limits reset at midnight UTC.

Plan Daily AI/MCP requests
Trial 30
Starter 100
Standard 500
Pro 1,000
Enterprise 50,000

CoreDash PricingCore Web Vitals CoreDash Pricing